PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_825A1B8BD.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 129aa    MW: 15026.2 Da    PI: 11.0092
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_825A1B8BD.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.66.1e-132371147
                           HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           +l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  Traes_3AL_825A1B8BD.1  2 KLRELVALYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 37
                           799*******************.***********996 PP

2Myb_DNA-binding551.8e-174587246
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                            +++ eE+e+l  a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Traes_3AL_825A1B8BD.1 45 RPFSDEEEERLMAAHRFYGNK-WSMIARLFP-GRTDNAVKNHWHV 87
                           68*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0011140IPR001005SANT/Myb domain
PROSITE profilePS5129415.677138IPR017930Myb domain
PfamPF002493.2E-12237IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-21245IPR009057Homeodomain-like
CDDcd001671.88E-9236No hitNo description
SuperFamilySSF466893.25E-261897IPR009057Homeodomain-like
PROSITE profilePS5129424.9583993IPR017930Myb domain
SMARTSM007175.5E-134391IPR001005SANT/Myb domain
PfamPF002491.5E-134486IPR001005SANT/Myb domain
CDDcd001672.85E-104686No hitNo description
Gene3DG3DSA:1.10.10.603.1E-214692IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MKLRELVALY GPQNWNLIAE KLDGRSGKSC RLRWFNQLDP RISKRPFSDE EEERLMAAHR  60
FYGNKWSMIA RLFPGRTDNA VKNHWHVIMA RKYREQSIAY RRRKLNQAVQ RTLDSSSGVA  120
AGAGHVDVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-3029217107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-153HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001141752.13e-79uncharacterized protein LOC100273887
RefseqXP_014755863.14e-78PREDICTED: myb-related protein 3R-1
SwissprotQ9FDW13e-36MYB44_ARATH; Transcription factor MYB44
TrEMBLW5CEC43e-93W5CEC4_WHEAT; Uncharacterized protein
STRINGMLOC_3926.13e-83(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.11e-64myb domain protein 117
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]